PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g012000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 349aa    MW: 39740.5 Da    PI: 5.4376
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g012000.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox246.6e-082983312154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp++e++++L +++gL+ +q+ +WF N+R +
  Sopen08g012000.1 298 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 331
                       469*****************************87 PP

2ELK285e-10252273122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELKh+L+++Y+++L+++++E++
  Sopen08g012000.1 252 ELKHELKQGYKEKLVDIREEIL 273
                       9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-1787131IPR005540KNOX1
PfamPF037902.2E-1689130IPR005540KNOX1
SMARTSM012561.8E-28140195IPR005541KNOX2
PfamPF037916.7E-20145194IPR005541KNOX2
PfamPF037891.8E-6252273IPR005539ELK domain
SMARTSM011889.2E-4252273IPR005539ELK domain
PROSITE profilePS5121310.144252272IPR005539ELK domain
PROSITE profilePS5007111.742272335IPR001356Homeobox domain
SMARTSM003891.9E-11274339IPR001356Homeobox domain
SuperFamilySSF466893.46E-16274338IPR009057Homeodomain-like
CDDcd000862.50E-11275336No hitNo description
Gene3DG3DSA:1.10.10.602.0E-25279336IPR009057Homeodomain-like
PfamPF059207.5E-18292331IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MDMPDQSSPI LMTSLPEQDV KPLEHQQPPP TWLNREILLP QTQYTGESNS NQWLSRFSLQ  60
RNVQASNDSD LTKDEFGESE AVNWQNAGYK SEILAHPLFE QLLSAHVACL RIATPVDQLP  120
RIDAQLAQSQ QVVGKYSGLG HGNLSDDKEL DQFLTHYVLL LCSFKEQLQQ HVRVHAMEAV  180
MACWEIEQSL QSLTGISPGE GTGATMSDDE DEQVDSDANL FEGSLDGHDS MGFGPLIPTE  240
SERSLMERVR QELKHELKQG YKEKLVDIRE EILRKRRAGK LPGDTTSVLK AWWQSHSKWP  300
YPTEEDKAKL VQETGLQLKQ INNWFINQRK RNWHSNPSSS TALKSKRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A7e-13275339872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1328348RKRNWHSNPSSSTALKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0047970.0AB004797.1 Nicotiana tabacum NTH23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015085237.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X2
SwissprotP480001e-177KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLK4CK430.0K4CK43_SOLLC; Uncharacterized protein
STRINGSolyc08g041820.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-179KNOTTED1-like homeobox gene 3